Activity 4. Make a Dichotomous Key. Make a Dichotomous Key for the animals illustrated below https:/pixabay convecinrs/biodiversity earthworm- fertlizer-160380V httpa /commons.wikimedia org'aikiFile.CSIRO Scienceolmage 2186 A ROd Bac Sprorp https://www.flickr.com/photos/queenslandstatearchives 137884088126 https://en.wikipedia.org/wiki/Tamaraw II IV
Q: In living cells, the hydrolysis of ATP to ADP + P is the main supply of energy. ATP releases its…
A: * ATP is called Adenosine triphosphate which is an energy carrying molecule that can be found in…
Q: What are some of the criteria and tools biologists might use to assign the different types of…
A: Previous classification takes into account three different types of taxonomic relationships, which…
Q: A biologist is studying an organism that is single-celled. With only this information, we know that…
A: The living organisms are classified into different groups depending upon there characteristics. In…
Q: What are 5 examples of physiological adaptation in mammals (Note:Pls. specify the name of the mammal…
A: Physiological adaptation is a body's internal procedure that enables a life form to control and…
Q: In a population of 527 individuals, a locus has two alleles: T and t. If 148 individuals have the tt…
A: Hardy Weinberg equilibrium- explains that frequency of allels and genotypes remains constant from…
Q: 74) the first discovered human virus was a. rabies virus b. foot and mouth disease virus c. yellow…
A: The yellow fever virus was the first human virus to be discovered. Carlos Finlay (1833–1915), a…
Q: Using appropriate examples, discuss the variety of echinodermbody plans.
A: Echinoderm are the animals in which endoskeleton of calcareous ossicles are present. All echinoderms…
Q: During the fermentation process what happens to the lactose (milk sugar)? What are the end products…
A: Introduction Fermentation is a metabolic process that uses enzymes to cause chemical changes in…
Q: 69)At the genetic level, what would indicate that an allele has experienced positive selection he…
A: Disruptive selection favors both dominant and recessive traits but not intermediate traits. Whereas,…
Q: List the components of the enzyme complex involved in the transition step and Simply describe…
A: Components of the enzyme complex :-
Q: Which of the following is/are true about the signal recognition particle (SRP). Choose all that…
A: SRP is defined as the signal Receptor Protein that is a ribonucleoprotein particle and helps in…
Q: what conditions do bacteria need to grow ? think about the condition needed for yeast and if these…
A: Bacteria are prokaryotic organisms devoid of nucleus and membrane bound organelles.
Q: The primary lipid components of the membranes of extreme thermophiles are O A. sulfolipids O B. 20…
A: * Thermophiles are organisms organisms that can lives at relatively high temperatures, between 41…
Q: Eye Color (B, b) (B dominant for brown eyes; b for blue eyes) If Mrs. Spud's genotype is Bb and Mr.…
A: The alleles are the alternative forms of a gene that are located on the same locus of a homologous…
Q: 53) The sheeppox and goat pox virus are both found in Africa and Asia only. Select one: F/T 54) the…
A: Introduction - A virus is a very small infectious agent (can't be seen with naked eyes) that only…
Q: What are the steps to DNA replication?
A: DNA replication is responsible for producing complementary ds DNA molecule from parental dsDNA…
Q: Animal models of disease are often used in biomedical research. Why is it important that the use of…
A: * Animals are used in biomedical research for producing antibiotics and vaccines rather than…
Q: С. What are the expected genotypic ratio, and phenotypic ratio of green to red if: i. the Fi's are…
A: a person or strain whose chromosomal complement is made up of four copies of a single genome as a…
Q: Provide an example of a molecule that cannot pass through the membrane? Can pass but with…
A: Cell membrane or plasma membrane is considered as semi permeable membrane because it allows certain…
Q: The lac operon consists of three structural genes, lacZ, lacY and lacA that are transcribed as a…
A: ii) LacP is called the promoter gene of lac operon.
Q: Which of the following can be correctly deduced from the figure? G; checkpoint- G Source Jene Reece,…
A: NOTE: Since you have posted multiple questions. so we will be solving the first three for you. If…
Q: 95) The herpesviruses: a. Can have an abortive infection b. Have three round of protein translation…
A: INTRODUCTION Herpes virus These are contagious viruses transmitted by skin to skin contact. They are…
Q: The lac operon consists of three structural genes, lacZ, lacY and lacA that are transcribed as a…
A:
Q: 16) The RNA dependent DNA enzyme: a. Is found in the mature hepatitis D virus. b. Is found in the…
A: Enzymes can be described as the proteins that aid in the speeding up of bodies' metabolism or…
Q: Which checkpoints ensure that growth factors are available and check whether DNA replication in S…
A: Cell checkpoint checks error in the cell cycle progression.
Q: Unknown virus dsDNA contains 36% AT on a molar basis. What are the mole percentages of A, G and C…
A: Double-stranded (ds) DNA (Deoxyribonucleic acid) is composed of two strands. DNA is composed of…
Q: Instruction: Fill up the table by computing the dominant alleles, recessive alleles and the…
A: According to Hardy Weinberg equilibrium- p2 + 2pq + q2= 1 and p+q= 1 p = frequency of the dominant…
Q: capable of converting peroxisome hydrogen peroxide to water and oxygen destroys engulfed bacteria…
A: Answer :- * capable of converting hydrogen peroxide to water and oxygen :- peroxisome. * Destroys…
Q: uses hydrolases both lysosome and peroxisc uses the enzyme catalase [ Choose ] is one of the main…
A:
Q: When Charles Darwin discovered the various fish species on the Galapagos islands he was surprised to…
A: Charles Robert Darwin, an English naturalist, suggested the "Theory of Natural Selection" by…
Q: what causes activation of certain genes before fertilization?
A: Fertilization is the process of fusion of male and female gametes for the formation of a zygotes.
Q: 1. Embryonic development occurs during this period. A. from the ninth week of gestation to birth…
A: Here I discuss about embryonic development and gastrulation.
Q: 5) The RNA polymerase (DDRP), one option is incorrect : a. Can work to produce the genomic RNA of…
A: B answer is incorrect.
Q: There are 4 types of movement based on microtubules and microfilaments. List them, as well as two…
A: Movement is condition when the living organism moves a body part to bring without a change in the…
Q: Which of the following statements is false? O The sun provides energy which then becomes usable in…
A: Ecosystem is the finite arrangement of the biotic and abiotic factors of a environment to support…
Q: flies from the first analysis and a fly that is homozygous for a gray body and vestigial wings. UN…
A: >> Let gray body gene be denominated by G and ebony body gene by g. Similarly long wings be…
Q: Imagine a warm pond on the primordial Earth.Chance processes have just assembled a single copy of…
A: RNA is a molecule that plays a vital role in many biological processes, including protein synthesis,…
Q: 100) The HA protein of Influenza vaccine is a. The HA1 is responsible for binding to unexposed…
A: Answer :- Option (B) is correct. - The HA protein of influenza vaccine is the HA protein of the…
Q: The figure shows the level of genetic diversity at three loci in two species of elephant seals.…
A: Genetic diversity at a specific locus is affected by evolutionary factors.
Q: transport of respiratory gases in humans to transport of water in vascular plants.
A:
Q: When microbiologists are working with bacterial batch cultures, we would expect to see no net change…
A: The most frequent laboratory growth method for studying bacterial growth is batch culture, however,…
Q: The first step of a urinalysis procedure, before testing with a reagent stick, is to visually…
A: Introduction In humans and many other animals, urine is a liquid by-product of metabolism. Urine…
Q: Breifly desrcibe an experimentthat could distinguish between semiconservative and dispersive…
A: * Meselson and Stahl conducted experiment on DNA replication to distinguish between semiconservative…
Q: Instruction: Fill up the table by computing the dominant alleles, recessive alleles and the…
A: Hardy Weinberg principle It is a principle that states that the population will remain constant from…
Q: Compare an open circulatory system with a closed circulatorysystem, and note which groups of…
A: A circulatory system is a transport system that transports nutrients, gases, and other molecules…
Q: Gli3 and distal Hox gene expression Gradual reduction in distal Hoxd dosage Ноxd13 +/+ +/- +/+ +/-…
A: Hox genes specifies the identity of the limb region. It also sepcifies whether a particular…
Q: what are some physiological, behavioral, or antamoical similiarties of a brown-throated sloth and…
A: * Convergent evolution is independent evolution with analogous structures that have similar function…
Q: The lac operon consists of three structural genes, lacZ, lacY and lacA that are transcribed as a…
A: Lac operon has *3 structural genes- lacZ, lacY, lacA *promoter, *operator, *terminator, *regulator.
Q: For each - choose either peroxisome or lysosome, both or neither uses hydrolases both lysosome and p…
A: Note: Since you have asked multiple question, we will solve the first question for you. If you want…
Trending now
This is a popular solution!
Step by step
Solved in 2 steps
- Choose correct answers Eastern Spruce Budworm (Choristoneura fumiferana) exclusively feeds on spruce. Tennessee Warbler and Cape May Warbler have positive associations to Spruce Budworm outbreaks. Eastern Spruce Budworm outbreaks occur every 10 years. BTK is effective to control Spruce Budworm pupae and adults.PO1583 ILIA HUMAN P16598 ILIA RAT PO1582 ILIA MOUSE P18430 ILIA PIG P48089 ILIA MACMU Q28579 ILIA SHEEP PO1583 ILIA_HUMAN P16598 ILIA RAT PO1582 ILIA MOUSE P18430 ILIA PIG P48089 ILIA MACMU Q28579 ILIA SHEEP PO1583 ILIA HUMAN P16598 ILIA RAT PO1582 ILIA MOUSE P18430 ILIA PIG P48089 ILIA MACMU Q28579 ILIA SHEEP 1 1 MAKVPDMFEDLKNCYSENEEDSSSIDHLSLNOKSFYHVSYGPLHEGCMDQSVSLSISETS MAKVPDLFEDLKNCYSENEEYSSAIDHLSLNQKSFYDASYGSLHENCTDKFVSLRTSETS MAKVPDLFEDLKNCYSENEDYSSAIDHLSLNQKSFYDASYGSLHETCTDQFVSLRTSETS MAKVPDLFEDLKNCYSENEEYSSDIDHLSLNOKSFYDASYEPLPGDGMDKFMPLSTSKTS 1 MAKVPDMFEDLKNCYSENEEDSSSIDHLSLNOKSFYDVSYGPLHEGCMDQSVSLSISEIS MAKVPDLFEDLKNCYSENEDYSSEIDHLSLNOKSFYDASYEPLREDHMNKFMSLDTSETS 1 1 (i) (ii) 699996 : KTSKLTFKESMVVVA---TNGKVLKKRRLSLSQSITDDDLEAIANDSEEEIIKPRSAPFS KMSTFTFKESRVVVSATSNKGKILKKRRLSFNQPFTEDDLEAIAHDLEE-TIQPRSAPHS KMSNFTFKESRVTVSATSSNGKILKKRRLSFSETFTEDDLQSITHDLEE-TIQPRSAPYT KTSRLNEKDSVVMAA---ANGKILKKRRLSLNQFITDDDLEAIANDTEEEIIKPRSATYS…purses/1221013/quizzes/4380236/take/questions/44637011 1 O Virtual School Admi... My Drive - Google. Johnny Upgrade - P... O (6793) YouTube S Savvas Question 2 1 pts The graph shows how a Serengeti buffalo population changed over a period of years. During this time period, the buffalo were affected by the rinderpest virus, a debilitating disease with a high mortality (death) rate. However, the virus was eventually eliminated from the population. Population Growth of Serengeti Buffalo 70,000 40.000 50,000 40,000 30.000 20.000 18 20 2. 8 10 12 14 Time (years) Which of the following inferences is supported by the graph? A. The predator population increased in year 16. B. The ecosystem can sustain, at most, 50,000 buffalo. C. The virus was eliminated from the population during year 3. D. The ecosystem is healthiest with a population of 30,000 buffalo. Number
- holyoke community college - Se x H Holyoke Community College | H X in Chapter 1 Question Set- Due 5/2 x C https://moodle.hcc.edu/mod/quiz/attempt.php?attempt=1391804&cmid=1678584 HCC Online English (United States) (en_us) ▼ Sn 1 Which of the following is not a fundamental characteristic of living organisms? et Select one: O a. made of cells O b. acquire and use energy O c. have hereditary information O d. replicates O e. n product of evolution O f. moves around to find food Which of the following is true about a hypothesis? Select one: O a. A hypothesis must be correct. O b. A hypothesis must be falsifiable. O c. A hypothesis can only be made by a board-certified scientist. O d. Scientists always develop their hypothesis after performing an experiment. A crocodile needs to act fast in order to catch prey. They more nourished the crocodile, the better its chance of survival and th to reproduce. Over time, a group of crocodiles become genetically predisposed for speed. Natural selection…Pitt ← → M Gmail T = 6 с Cour X = All content psyc x PB Mod X YouTube Maps app.tophat.com/e/379870/assigned/item/1114954::9dee415d-a4e0-482c-89a1-63ad1a2ee182 6 Unanswered question(s) Classroom Assigned 6 Inter x S Awe x KnightCite Citatio... Courses / BIOSC1000 Biochemistry Fall 2023 Homework 1 HOMEWORK • Due Sep 1, 11:59 PM Q Search sharky Gradebook Charles Schwab ● Prac X Join: 379870 Homework 1 Homework Due in a day E-Account | Peopl... a Dourid Aboud - H... Dash X 1. Cale x G psyc x # Image 1 Image 2 Image 3 BIOS X 2. Rho Psi Study Pad... 14/20 answered Ice floats because of the electronegativity of oxygen that withdraws electron density from the covalently bonded hydrogens. This results in a permanent dipole, leaving a partial positive charge on the hydrogens. The extra electron density on the oxygen leaves a partial negative charge. Therefore, water is a polar molecule and has the ability to form hydrogen bonds. These properties explain many of water's characteristics, including…| Sites Performance Matters | OLA olamiami.performancematters.com/ola/ola.jsp?clientCode-fIMiamiDade# Biology Unit 4 Assessment 20 A group of ponies lives in Chincoteague National Wildlife Reserve in Virginia. What could cause the development of longer legs to be selected over time? O A cause might be the decrease of rate of reproduction of the long-legged ponies O A cause might be that it made the long-legged ponies run more slowly O A cause might be that it prohibited the long-legged ponies from using available food resources O A cause might be the increase of survival rate of the long-legged ponies 4:29 PM 民 3/11/2021 O Type here to search
- S A short-haired cat has a litter of aize i savvasrealize.com/community/classes/5f45b0462f30c16a08876ab6/assignments/096cf30e17ac4674a4a496271bfe181e/content/a1059caf-d85e-4945-8c07-20d5e3135a8c/1/.. Due 06/08/2 Grade End-of-Term Exam Lucy volunteers at an animal shelter, and she takes care of an orange tabby cat and her kittens. Some of the kittens have orange markings, but some have gray markings. What units of genetic material determine how living things look? A traits B. genes variations D. mutations Review progress Question 22 of 23 + Back Next > d 255 6/8/ ype here to search 米 10 II insert prt @ 2$ng.c X https://assignment.itslearning.co x 9https://assignment.itslearning.c x PDF Reader - View, Edit, and Con X ignment.itslearning.com/mvc/Attachment/Get?Fileld%-M4lwUXm6r06na1JFB4B7TvjP7UpLpDF%2f%2bbc8wkWTVJCCCv%2F15XCE Unit Practice Problems and Homework_Incomplete Dominance Worksheet_NonDominance Worksheet Saved to itslearning v Layout References Review View Help O Editing Roman 12 A A A 三 O Find AaBbCc AaBbCc A- AaBbCc No Spacing ab x, x Aav v Normal Heading 1 Replac Font Paragraph Styles Editing 5. In cattle, the RR genotype calls for a red cow; the WW for a white cow; and the RW calls for roan color. A red bull and a white cow are mated. What types of offspring would be expected? Give the genotypes and phenotypes and the probability of each. 6. A cattle breeder knows that the hornless condition (H) is dominant over horned (h). He mates a heterozygous hornless cow who is roan colored with a horned roan bull. What types of offspring would be expected from this cross? Give the…IHGUR.AEMI?_28n=condexternal_browser=0&launchUrl=https%253A%252F%252Fnewconnect.mheducation.com6252F/activ Ch. 9 Quiz fi Saved Help Save & Exit Submit Sexual reproduction is important to the survival of a species in a changing environment because Multiple Choice eook References It produces genetically different individuals. it produces genetically identical individuals. All answers are correct it requires only one individual It requires less overall energy expenditure than asexual reproduction O OHelp label the 2 picturesSEE MORE QUESTIONS