Q: Which list best describes the path taken by newly synthesized proteins, beginning with the synthesis…
A: Proteins are the building blocks of the body and its functional unit. It is made up of a long chain…
Q: Describe the different stages that process of Protein synthesis.
A: Protein synthesis is the cycle where cells make proteins. It happens in two phases: transcription…
Q: This happens during DNA transcription:
A: Hi! Thank you for the questions. As you have posted multiple questions, I will be answering the…
Q: Explain how in some cases a single nucleotide change in a DNA sequence can have very detrimental…
A: Mutations is the sudden heritable change in the make up of gene. Mutation basically occur by…
Q: Briefly present and explain why transcribed RNA is complementary to one strand of DNA.
A: Transcription is the process by which RNA is produced from the DNA template. It is occurs within the…
Q: How to purify expressed protein
A: Purification is the process where the specific protein is separated or each protein from a mix of…
Q: pathway of proteins from the nucleus
A: Proteins bound for the core (nucleus) contain NLSs. These short stretches of amino acids communicate…
Q: The soul has a way of knowing where to start reading a DNA sequence in order to determine the…
A: DNA is transcribed into a DNA and RNA is translated into proteins that is the DNA is ultimately…
Q: Discuss the possible effects of a defective tubulin gene in a cell
A: Answer: TUBULIN = This is a type of protein that combines and forms in to long chains and filaments…
Q: What molecules thought to have performed double duty as a genetic materal and performing catalyss of…
A: Any material of plant, animal or other origin that carries genetic information from one generation…
Q: protein that charges its conformation ( and often its activity) when it binds a regulatory molecule…
A: Answer - Ligase - The RNA primer is responsible for initiation of DNA synthesis are removed by…
Q: During DNA replication in a typical human cell...
A: The method of replicating a double-stranded DNA molecule into two identical DNA molecules is known…
Q: DNA replication involves a
A: DNA Replication: DNA is a self replicating material which carries the genetic information of the…
Q: b. How is the DNA information used to make proteins for ongoing cellular processes and cellular…
A: Introduction DNA is the molecular structure that is composed of a pair of polynucleotide chains and…
Q: biguitation lêdds to . Degradation of protein into amino cids =. Attack of ubiquinated protein by…
A: Ubiquitylation (sometimes called ubiquitination or ubiquitinylation) is an enzymatic…
Q: You have designed a drug to stop the DNA replication process in cancerous cells. Explain how your…
A: The cell division process is a highly controlled mechanism that divides a cell into two daughter…
Q: Control of Gene Expression, type of of Gene Expression.
A: Ans: Gene expression: Gene is expressed meaning when DNA is transcribed from the coding region by…
Q: The protein will lose its conformation when denatured by some factors such as a big change protein…
A: Proteins is a complex chemical structure that is formed by amino acids. Amino acids in protein join…
Q: Describe DNA Damage: Definition: Define DNA damage. What are some causes of DNA damage? What…
A: (a) DNA damage as the term suggest is the abnormal chemical structure in the DNA molecule. It is…
Q: Adenosine triphosphate is an imortant molecule becauseit
A: Electron transport chain is mechanism which takes the electrons from the electron donor and gives to…
Q: Mutations in the RB gene are often associated with cancer. Explain how a mutation that results in a…
A: The cell cycle is the series of stages that allow the cell to pass from one cell division to…
Q: Which of the 4 steps are most important and why
A: Gram staining is a method in which cells stain either pink (gram-negative) or purple (gram-positive)…
Q: Consider a disease that arises from incorrect DNA replication. describe the disease and the ways in…
A: DNA replication is a highly accurate procedure, but errors will sometimes occur as if a wrong base…
Q: e impact of mutations on the function of the protein
A: Mutation can lead to change in the triple base pair sequence which can lead to change in the amino…
Q: or each denaturing agent, explain the changes that can be observed in terms of change in protein…
A: Denaturation is the loss of the native proteins' three-dimensional structure. Denaturation is the…
Q: Mutations within a DNA sequence are
A: Mutations are errors in the DNA replication process. It may be either due to mistakes when the DNA…
Q: Translation of DNA
A: Gene is the structural and functional unit of DNA. Gene is made of nucleotide base pairs. Gene is…
Q: ene is responsible for
A: A factor is that the basic physical and useful unit of heredity. Genes are created of polymer. Some…
Q: Gene are made of what
A: The genetic material is responsible for the inheritance of characters from one generation to the…
Q: Proteins that actively protect cells from progressing toward cancer are called _____________.
A: A tumor suppressor is the regulation of cell division by keeping cells from proliferating ( growing…
Q: . ___________________________ factors are proteins thatregulate or initiate RNA synthesis by binding…
A: The transcription process involves the formation of the RNA (mRNA) from the template DNA molecule,…
Q: utations and the effects of genetic mutation
A: Mutation can be defined as the change in the DNA sequence. The process of Mutations can result from…
Q: the purpuse of mRNA in regard to producing protein
A: Transcription:As deoxyribonucleic acid (DNA) is bound within the nucleus but a synthesis of protein…
Q: EXAMPLES OF DNA TRANSLATION
A: DNA translation is the process in which the DNA is first transcribed into an mRNA and then the…
Q: onstruct and explanation based on evidence of how the structure of DNA determines the structure of…
A: According to the central dogma of molecular theory, the information stored in the DNA is first…
Q: CHANGE OF THE PROCESSES THAT CHANGE GENETIC INFORMATION INTO ITS NEW FORM
A: Genetics is one of the diverse and widely studied branch in the field of science. It is a branch of…
Q: the genetic information is coded in DNA by the the sequence of
A: The sequence of DNA bases is arranged into genes, most of which contain the instructions to create a…
Q: Explain how a protein ensures that it binds specifically to only a certain region of DNA and not…
A: DNA binding proteins have structural compatibility by the presence of DNA binding domains which make…
Q: Explain the genetic alterations resulting in protein synthesis defects and their relationship to…
A: In genetics, the genetic alterations is defined as the abnormalities that is caused due to the…
Q: Irreversible binding of nucleic acids Inhibition of enzymes responsible for DNA synthesis Blockage…
A: Irreversible binding of nucleic acids: Leukeran
Q: which molecule copies the DNA message for building a particular protein? what is this process…
A: Deoxyribonucleic acid (DNA) is a self-replicating substance that is found in almost all the living…
Q: Rapamycin is an anti-cancer drug, what protein does rapamycin act upon?
A: According to the question, Rapamycin is an anti-cancer drug, we have to mention the name of the…
Q: Match each process with its product._____ transcription a. DNA_____ replication b.…
A: Central dogma explains the flow of genetic information. It states that information flows from DNA to…
Q: What are the main functions of DNA and RNA in human body.
A: BASIC INFORMATION CELL It is considered as the basic unit of life Every organism is made up of…
Q: Describe the consequences of removing or adding nucleotides.
A: Changes in nucleotide bases produce mutations, which are errors in codons. It's possible that…
Q: How flexible protein domain helps to connect DNA binding domains to activation domains
A: In the polypeptide chain of the protein, the region that stabilizes on its own and folds…
In denaturation of DNA and protein explain how denaturation brings about the ailment and what its effect in our body.
Step by step
Solved in 2 steps
- Barth Syndrome describe how it impacts overall cellular function in those afflicted by the disorder?Briefly describe the process of protein making.include the functions of mRNA ,tRNA, and rRNAExplain the genetic alterations resulting in protein synthesis defects and their relationship to disease processes such as sickle cell anemia and polycystic kidney disease.
- Example of protective proteinsBence-Jones protein is a protein with a molecular weight of approximately 150 kDa and is found in high concentration in the urine of Multiple Myeloma patients. Multiple Myeloma is a type of cancer in which lymphocytes multiply and break down bone marrow and bone. Which method would you prefer to show the Bence-Jones protein in the urine for the diagnosis of the disease? Explain the principle of your preferred method.The Bence-Jones protein is a protein with a molecular weight of approximately 150 kDa and is found in high concentration in the urine of MulKpl Myeloma patients. MulKpl Myeloma is a type of cancer in which lymphocytes multiply and break down bone marrow and bone. Which method would you prefer to show the Bence-Jones protein in the urine for the diagnosis of the disease? Explain the principle of your preferred method.
- Protein: HemoglobinCircle and underline each codon, amino acid sequence, make a mutation of the 3rd codon in the nucleotide sequence and circle the affected areas, show the amino acid area with the mutation.Lastly, describe the impact on the protein."MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFR". Please explain the role of Ubiquitin Ligase Activity in the regulation of apoptotic cell death.To distinguish: The integral and peripheral proteins.
- b. How is the DNA information used to make proteins for ongoing cellular processes and cellular maintenance?Discuss protein folding and misfolding. Give two consequences (or examples) of protein misfolding and describe the effect of the misfolding.Briefly present and explain why transcribed RNA is complementary to one strand of DNA.