Posttranslational modifications for collagen

Q: ADH1A alcohol dehydrogenase 1A (class I) Describe a way in which the gene can be manipulated to…

A: * The gene ADH1A alcohol dehydrogenase  gene encodes a member of the alcohol dehydrogenase family.…

Q: The text states that ATP is synthesized primarily by energy metabolism,whereas other nucleoside…

A: Adenosine (ATP) triphosphate is the energy compound, which helps to catalyze several metabolic…

Q: Which of the following is not a polypeptide posttranslational modification? O Phosphorylation O…

A: DISCLAIMER: Since you have asked multiple questions, we have solved the first question for you. If…

Q: Polypeptide folding is often mediated by other proteins called chaperones. Describe how a mutant…

A: Chaperones are proteins that guide proteins along the proper pathways for folding. They protect…

Q: Human insulin protein MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGG…

A: The polymerase chain reaction is a molecular technique responsible for exponentially amplifying a…

Q: How does the aminoacyl-tRNA synthetase that attaches the amino acid proline know which tRNA to…

A: tRNA is a small, well-characterized RNA molecule which plays a key role in protein biosynthesis.…

Q: Sequentially list the signal transduction process from ligand binding to biological response for the…

A: Phospholipase C (PLC) is a class of enzymes that cleave the membrane phospholipids at the position…

Q: Even though the actual concentration inside a cell is above critical concentration, 50% of action is…

A: Actin participates in many important cellular processes, like muscle contraction, cell motility,…

Q: ACTIVITY 4.1.2 b highlight the side chain that is unique. Unique features and function Amino acid…

A: Amino acids are molecules that makeup proteins. A typical amino acid has a central alpha carbon to…

Q: Vitamin C is required for- a) Posttranslational modification b) Synthesis of epinephrine c) Tyrosine…

A: - Vitamin C is also known as ascorbic acid and it acts as reducing agent and scavenger of free…

Q: *H3N -Č-H CH2 он Tyrosine Draw the structures of tyrosine as different pH values. Please refer to…

A: Ionization state of any amino acid is decided by its pKa value and pH of solution. pKa and pH both…

Q: blood type A, ___ is found at the nonreducing end of the oligosaccharide portion of the…

A: The oligosaccharides which are involved in the ABO blood types, and are located outside of the cell…

Q: I want you to prepare a report of 2-3 pages summarizing the genetic disease (Kearns -sayre syndrome…

A: Kearns-Sayre condition (KSS) is a rare neuromuscular disorder with beginning generally before the…

Q: Why must glycine be found at regular intervals in the collagen triple helix?

A: Introduction: Proteins are biomolecules that consist of long chains of amino acids. The structure of…

Q: Which peptide would absorb the most UV light at 280nm? (Can you show work because I mainly want to…

A: Aromatic amino acids are relatively non polar.  All aromatic amino acids such as tyrosine,…

Q: The arrangement of coiled-coil dimers in the tetrameric intermediate filament subunit makes them…

A: Intermediate filaments are the highly stable components of the cytoskeleton of the majority of…

Q: Certain glutamine analogs irreversibly inactivate enzymes that bind glutamine. Identify the…

A: Nucleotides are ubiquitous as they are involved in majority of biochemical reactions. All of the…

Q: I want you to prepare a report of 2-3 pages summarizing the genetic disease (Kearns -sayre syndrome)…

A: A genetic condition is an illness caused in part or entirely by a deviation from the usual DNA…

Q: Ubiquitin Marks Cytosolic Proteins for __________ in Proteasomes.

A: Answer is . Degradation

Q: BIM-46187 is a protein inhibitor that binds to the a-subunit of the G. protein. It prevents the…

A: Cell signaling is the conversion of the information in a signal into cellular response. Ligands,…

Q: Instructions: Type the one letter code using CAPITAL LETTERS ONLY. Do not include spaces between the…

A: Amino acids are the building blocks of protein and they continue the alpha-amino group, carboxyl…

Q: Explain the biochemical and subsequent medical consequences of a deficiency of Myoadenylate…

A: Myoadenylate deaminase insufficiency is a metabolic muscle disorder in which the muscle cell's…

Q: EF-Tu: EF-Ts as ORF-1:RF2 eEF1A:eEF1B O Shine-Dalgarno:5'-7mG O Co-translation: post-translational…

A:

Q: All of the following covalently interact with ubiquitin except: O E2 conjugating enzyme O E3 ligase…

A: Cell signaling is part of any interactive activity that directs the basic activities of cells and…

Q: pxylation and cros yzed by lysyl hydr- aares transcrintion aases

A: Mutation :- Mutation is alteration in nucleotide sequence of genome either it is virus or any…

Q: 1.) What are the main structural features of the mucupolysaccharides chitin? 2.) How do this aid in…

A: Chitin is a carbohydrates polymer that is composed of N-acetyl D-glucosamine units attached together…

Q: Write the chemical structure of peptide containing the following amino acid PRO-SER-GLY-LEU

A: Amino acids are building blocks of the protein molecule. There are twenty different amino acids.  An…

Q: Draw 3 isomers of C7H12O2 then state where you wil disposal should only be repeated once).

A: Heptanedial is represented by C7H12O2. The molar mass of the given compound is found to 128.2 g/mol.…

Q: What's the simple rule to predict ligand binding sites for Rossmann Fold

A: Proteins are polypeptides consisting of unbranched polymers constructed from 22 standard α-amino…

Q: There is another melanocyte-stimulating hormone called β-melanotropin.Cleavage of β-melanotropin…

A: The cells in the middle lobe of the pituitary gland contain melanocyte-stimulating hormone and they…

Q: I want you to prepare a report of 2-3 pages summarizing the genetic disease (Kearns -sayre syndrome…

A: Kearns-Sayre condition (KSS) is a rare neuromuscular disorder with beginning generally before the…

Q: The ES complex may be destabilized by:

A: NOTE: AS PER OUR GUIDELINES WE ARE ONLY SUPPOSED TO ATTEMPT THE FIRST QUESTION, PLEASE RESUBMIT THE…

Q: Question Completion Status 30 31 32 33 34 12 13 14 16 17 1 2 10 7 11 QUESTION 17 The titration curve…

A: A titration of amino acids is a process in which base added gradually to neutralize the acids, the…

Q: Compare and contrast structural features of collagen and α-keratin (OK to do this as a list or table…

A: Proteins are polypeptides. They are linear chains of amino acids linked by peptide bonds. Each…

Q: This lysosomal storage disease is treated by reducing complex sphingolipid accumulation with the…

A: The Lysosomal Storage Disease (LSDs) are due to defects in the metabolism which is inborn thus…

Q: A number of fragments that will be formed by cleaving the peptide Met-Ala-Lys-Met-Arg-Phe-Met-An by…

A: Proteins are one of the macromolecules present in the body. They provide structural support,…

Q: A. Lysine: Polar basic: Calcium absorption B. Proline: Nonpolar imino acid: Protein synthesis C.…

A: A. Lysine is basic, has R group that is significantly positively charged at pH 7. It has second…

Q: T/F Type I collagen fibers, that consist of collagen triple helices aligned side-by-side, are…

A: Proteins are unbranched polymers constructed from 20 standard α-amino acids. They have four levels…

Q: с" CH2 CH2 "НaN H с. CH С" CH Нзс CHз ZI о-о

A: The second amino acid in the given dipeptide is glutamate. It contains a negatively charged side…

Q: Irreversible cleavage of disulfide bridges is achieved by treating the protein with O a. Edman…

A: Asked : Irreversible Cleavage of disulfide bridges can be done by which of option

Q: why this position in your protein is important and outline the effects the mutation will have on the…

A: Function of 3GRS: Glutathione acts as an important antioxidant in your body. That means it helps…

Q: Shortly discuss the above antibodie structure? Please discuss at your own words . Discussion should…

A: The picture given is the basic structure of an antibody(immunoglobulin) which is a Y-shaped…

Q: Orotic aciduria is an autosomal recessive disease caused by a deficiency of the enzyme UMP synthase…

A: Orotic aciduria is a hereditary disease. It is an autosomal recessive disorder. It decreases the…

Q: Predominant nucleotides during protein synthesis are the GTPs.

A: Protein synthesis is the most important, essential, and significant metabolic activity of living…

Q: List three categories of posttranslational processing

A: Many polypeptides are covalently modifird, either while they are still attached to the ribosome…

Q: Suggest a reason why the amino acids thyroxine and hydroxyproline are produced by posttranslational…

A: Amino acids are building units of the protein molecules. They are synthesized by ribosomes according…

Q: Posttranslational modification occurs in the rough ER GC cmooth ED

A: INTRODUCTION The chemical changes that occur after a protein are produced are referred to as…

Q: Starting from glutamine + aspartate + glycine + CO + N-formyl-THF + ribose-5-P: How many ATP…

A: Nucleic acids are important as they act as the carrier of genetic information in all living…

Q: QUESTION 16 Protein maturation in the ER includes. OA Disuifide bend formation Li proteolytic…

A: Protein processing and modification occur in endoplasmic reticulum which has two sub units. Rough…

Tissue regeneration & repair

Tissue regeneration involves the restoration of tissue components by regrowth of damaged tissues. In contrast, tissue repair involves patching of injured tissue rather than restoring it. It is the proliferative capacity of the cells that decides the amount of regeneration against the repair that would occur in the tissue. Both regeneration and repair depending on the duration of the injury and response to the inflammation.