Refer to the below exhibit. Suppose you are working as a Linux administrator, you have been asked to count the number of available empty files in the specfied directory. Write the shell script named "file.sh" used to accomplish this task in your directory. [root@localhost ~]# mkdir student [root@localhost ~]# cd student [root@localhost utas]#touch id1.txt [root@localhost utas]#touch id2.txt [root@localhost utas]#touch id3.txt [root@localhost utas]#touch id3.txt [root@localhost utas]# cd .. [root@localhost ~]#
Q: Answer the following Linux question below. How can you append one file to another in Linux? Use the…
A: Given : Answer the following Linux question below. How can you append one file to another in Linux?…
Q: Which of the following commands or sequences of commands will rename a file x to file y in a Unix…
A: The given questions are multiple choice selected question so I can explain in detail below step.
Q: Write a Linux shell script that finds all files on /home that contain a given specific text string…
A: A shell is a command-line interpreter and typical operations performed by shell scripts include file…
Q: In PowerShell, Start-Transcript is a very useful cmdlet that creates a record of all or part of a…
A: Introduction Transcript of start that basically demonstrates about a particular text or alphabet…
Q: Suppose you are working with R and you find your current working directory by running the following:…
A: The solution for the above given question is given below:
Q: Which of the following commands or sequences of commands will rename a file x to file y in a Unix…
A: Answer the above question are as follows
Q: Write linux commands for the following tasks, you might use several commands to accomplish these…
A: cp command can be use to copy one or multiple file from SOURCE to DESTINATION: Here, SOURCE is…
Q: Please help with the following: Give the descriptiotn of the following commands in Linux adduser…
A: Given: Please help with the following: Give the descriptiotn of the following commands in Linux…
Q: After typing the command umask 731, the permissions on all subsequently created filesand directories…
A: Permissions: In Linux operating system, the permissions are written in the format where, The…
Q: Write linux commands for following cases in a sequential manner: Suppose you downloaded a file…
A: Linux is a open source operating system free for every one to use. Unlike windows operating system…
Q: Write the command that can be used to perform the following:a. Compress the symbolic link…
A: Hey, since there are multiple questions posted, we will answer first question. If you want any…
Q: In Linux operating system: When writing shell scripts, we rely on the echo command to display…
A: echo command is used to print on console \n is the special character used to represent a new line…
Q: IN linux As a regular user, you can run the command "chmod 777/etc/passwd" to make a…
A: This question comes from Operating System which is a paper of Computer Engineering. Let's discuss it…
Q: How does cron know the proper EUID to use when running commands in a user's crontab file? The…
A: Scheduling in Linux is being done by a system daemon named cron. The cron daemon executes tasks at…
Q: Create a shell script that lists all the files in the present working directory in long format name…
A: This is 3 questions As per bartleby policy I can answer only one of them solving the second…
Q: Consider the file named Plans on a Linux system. This file is owned by the user named "mary", who…
A: Linux permission r - read w - write x - execute first - means file type i.e d for directory and…
Q: Question 3 25 Marks Compose the required Linux commands for implementing the following file…
A: Answer Linux: It is a command based multi-user operating system which can be accessed by many users…
Q: Write Linux command for each question. Please use one single command to do following process. PLEASE…
A: Answers line by line below:
Q: Linux Quiz (Accurate answers please!) Write the command to create a directory
A: Given: Write the Linux commands.
Q: Question 3 : Suppose you have a C project in a folder called “project”, it contains .c and .h files,…
A: Question 3: Suppose you have a C project in a folder called “project”, it contains .c and .h files,…
Q: On certain Linux systems, the root user may be accessed by anybody, despite the fact that sudo is…
A: Linux is a free and open-source (OS), Managing a computer's hardware and resources, such as the CPU,…
Q: Can you help me modify the command PowerShell below? 1. You are asked to check that the computers…
A: #include <iostream>using namespace std; int main() {Get-Content .\computerlist.txt |…
Q: Which key allows you to autocomplete an existing filename in Linux when working in the console? Tab…
A: NOTE:“Since you have asked multiple questions, we will solve the first question for you. If you want…
Q: O O O O 6- For a directory on a Linux OS, if the user the group can read and execute only and t…
A: The permission code represents the permission structure for various users on the system.
Q: Question 18 Given the following code for a program called runme, choose the correct outp ut when it…
A: Dear Student, The code will not compile as gcc -o runme is not executed , it must be executed before…
Q: Refer to all the commands shown below. Suppose you are working as a Linux administrator; you have…
A: Write the appropriate command used to accomplish this task and save in a text file “myempty.txt” in…
Q: Below is a sequence of shell commands that we typed into a bash terminal window on a Linux machine…
A:
Q: Write a Linux shell script to perform the following tasks: a. Display current date and time b.…
A: (a) How to Format Display Date or Application in the Shell Script:- You need to use a standard date…
Q: Write a bash script to print out the output as such “DCS1106 Lab is all…
A: A Bash script is a plain text file that contains a series of commands. These commands are a mixture…
Q: what would the new umask value be? Files: rw-rw---- Directories: rwxrwx--x
A: UMASK in Linux or Unix systems is known as User Mask or it is also called as User file creation…
Q: Below is a list of different access right settings. We want to implement shared update of certain…
A: CHOICES: A. Assign Bob ownership to Alice's files, and Alice ownership to Bob's files. If we…
Q: Describe briefly the contents of the following Linux files, displaying the first five lines of each:…
A: intro What is Linux: Linux is the most well-known and widely used open-source operating system is…
Q: Write a script to automate the creation of new users and groups, i have this so far but the groups…
A: Solution : Shell Script: #!/bin/bash while [x$username = "x" ]; do read -p " Please enter the…
Q: Create a Linux shell script that will search for US phone numbers in files that are in a directory…
A: Answer: -d file - This option determines whether the provided file exists on the system and is it…
Q: Write a Bash script that removes all zero length ordinary files in the directory (including those in…
A: Step 1 The answer is given in the below step
Q: Question 10. The following is an entry in the password file in a Linux system, which a root user can…
A: The Linux file system password entry looks like a /etc /shadow file entry. In fact, the entry is a…
Q: Create a single command to read a file called program.c and write a file called unreadable.c, by…
A: *In case of multiple questions, only 1st one is to be solved. We need to write a command in Linux to…
Q: chmd (ugoa +/- rwx) chmd – octal system (0-7): 1=execute;2=write;4=read…
A: The Linux command line is a text interface to your computer. Often referred to as the shell,…
Q: A file has the following permissions: r-- --x-w-. The command chmod 143 would havethe same effect as…
A: Permissions: In Linux operating system, the permissions are represented with the help of notions of…
Q: Create a file in Kali Linux root directory with the name MyTest.txt. a. Generate a hash value for…
A: The first file input for MyTest.txt file is "Hello" . Then i generated a sha1sum value. Then made…
Q: do the following in the code The shell environment should contain shell=/myshell where /myshell is…
A: Programming is instructing a computer to do something for you with the help of a programming…
Q: do the following: ● Write a suitable command to a user cron job, will run "backup.sh" script at 8 am…
A: rite a shell script named “myscript.sh” to do the following:● Write a suitable command to a user…
Q: Use the diagram below for reference. You can assume you are logged in as the user "msaul" and are…
A: According to the information given:- We have to show the absolute path name on the basis of…
Q: do the following in the code The shell environment should contain shell=/myshell where /myshell is…
A: Actually, given question regarding shell environment.
Q: [root@localhost ~]# mkdir .first [root@localhost ~]# cd .first [root@localhost .test]# mkdir .second…
A: 1) ls is linux command to see what are the files in a given directory 2) -R option will recursively…
Q: linux / unix shell 1.1 What is the meaning of the following command: “chmod go+rw files.txt 1.2…
A: It is defined as a computer program designed to be run by the Unix/Linux shell which could be one of…
Q: Linux assignment Assume that the working directory contains the following files: adams.ltr.03…
A: I'm providing the answer of the above questions. I hope this will help. Thank You..
Q: On the cmsy255 server, write a bash shell script called usrinfo that displays information about a…
A: #!/bin/bash # First in order to make the script executable give executable permission to the script.…
Step by step
Solved in 2 steps
- Use Linux executable objectCode5 for this question. These files are on syccuxas01.pcc.edu in directory ~michael.trigoboff/cs201/quiz02LinuxFiles. The file is run from the Linux command line, and takes one positive numerical argument, like this: ./objectcode5 3 (You can enter any small positive integer instead of 3.) Command line arguments are passed to int main(int argc, char** argv) as arguments argc and argv. You should assume that argc is at ebp+8 and argv is at ebp+12. This code contains a function named what. Using gdb, figure out what the function named what computes: 1) the absolute value of n 2) n squared 3) the sum of the integers from 1 through n 4) factorial of nUse Linux executable objectCode5 for this question. These files are on syccuxas01.pcc.edu in directory ~michael.trigoboff/cs201/quiz02LinuxFiles. The file is run from the Linux command line, and takes one positive numerical argument, like this: ./objectCode5 3 (You can enter any small positive integer instead of 3.) Command line arguments are passed to int main(int argc, char** argv) as arguments argc and argv. You should assume that argc is at ebp+8 and argv is at ebp+12. This code contains a function named what. Using gdb, figure out what the function named what computes: Question options: 1) the absolute value of n 2) n squared 3) the sum of the integers from 1 through n 4) factorial of nUse less or more command to see what's inside of it for linux Consider the following GenBank Flat File: /home/jorvis/e_coli_k12_dh10b.gbk It contains a feature table with CDS entries which look like this: CDS 8238..9191 /gene="talB" /locus_tag="ECDH10B_0008"/codon_start=1/transl_table=11/product="transaldolase B"/protein_id="ACB01213.1"/db_xref="GI:169887506"/db_xref="ASAP:AEC-0000080" /translation="MTDKLTSLRQYTTVVADTGDIAAMKLYQPQDATTNPSLILNAAQ IPEYRKLIDDAVAWAKQQSNDRAQQIVDATDKLAVNIGLEILKLVPGRISTEVDARLS YDTEASIAKAKRLIKLYNDAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLFS FAQARACAEAGVFLISPFVGRILDWYKANTDKKEYAPAEDPGVVSVSEIYQYYKEHGY ETVVMGASFRNIGEILELAGCDRLTIAPALLKELAESEGAIERKLSYTGEVKARPARI TESEFLWQHNQDPMAVDKLAEGIRKFAIDQEKLEKMIGDLL" Using a single command, count the number of CDS entries within the file. Provide the command you used as well as the count returned.
- Suppose you have Java source files under the directorieschapter1, chapter2, . . . , chapter34. Write a program to insert thestatement package chapteri; as the first line for each Java source file underthe directory chapteri. Suppose chapter1, chapter2, . . . , chapter34are under the root directory srcRootDirectory. The root directoryandchapteridirectory may contain other folders and files. Use the followingcommand to run the program:java Exercise12_18 srcRootDirectoryThe following shell script adds entries to a file named journal-file in your home directory. This script helps you keep track of phone conversations and meetings. $ cat journal # journal: add journal entries to the file # $HOME/journal-file file=$HOME/journal-file date >> $file echo -n "Enter name of person or group: " read name echo "$name" >> $file echo >> $file cat >> $file echo "----------------------------------------------------" >> $file echo >> $file What do you have to do to the script to be able to execute it? Why does the script use the read builtin the first time it accepts input from the terminal and the cat utility the second time?A student launches the Python interpreter from his home directory. His home directory contains another directory called 'mydir', and 'mydir' contains two files called 'foo' and 'bar'. The home directory does not contain any files, only other directories. What will happen when he writes the following code at the Python prompt: >>> import os >>> filenames = os.listdir('mydir') >>> f= open(filenames[0]) ===================================================================================== A variable f representing a file object will be created, and the first file in the directory 'mydir' will be opened for writing in text mode. An error will be produced stating that the file to be opened does not exist. An error will be produced stating that filename is not subscriptable. A variable f representing a file object will be created, and the first file in the directory 'mydir' will be opened.
- Please log in as “root” and create a new directory called “myScripts”on your desktop (i.e., /root/Desktop).Please leave a comment with your name at the end of each of your script files. You can use “#” to insertcomments in your script. Write a script and save it as /root/Desktop/exercise1. This script performs the followingfunctions:a. Asks the user for the length and width (in feet) of a rectangular roomb. Calculates the area of the roomc. Displays the result to the userRun the script in terminal using the command: bash /root/Desktop/exercise1 SO I HAVE WROTE THE SCRIPT BUT I DON'T KNOW HOW TO SAVE IT TO EXERCISE1 AND DISPLAY IT, JUST NEED TELL ME HOW TO DO IT , NO NEED SCRIPTMD5 is a hash function producing a 128-bit checksum of a collection of bytes. You can read about it here. On Linux, the command to produce an md5 is /usr/bin/md5sum. On Macs, it is /sbin/md5. For example, on Linux the command$ md5sum fooprintsfceab221011657b8f7453d10009485f0to the screen. If the contents of two files (text or binary) are identical, then the md5 hash of the two files will be identical. Thus an easy way to detect identical files is to compare their md5 hashes.Write a shell script that accepts a directory pathname as its argument that prints the names of all files that are duplicates within that directory. If there is no argument, the current working directory is assumed. A hint that may or may not be useful: if two files have different sizes, they cannot be identical. Do not use either sed or awk in your solution. Your script should do something intelligent if the named directory does not exist, and should have reasonable exit codes.Part 2 OCTAL numbers have special usage regarding file permission. can you modify the permission by using OCTAL number? Assuming current working directory is "/home/test1/Exam1" and "rwxrw _r_ _" is the file permission setting of "Hello.java" . Remove the execution permission from the owner and add write permission to the other users in the other group
- Bash Shell Scripting – Misc. Commands Create a bash script ~/test4.sh with any text editor. Write a bash script that does the following: echo "File Name: $0" echo "First Parameter : $1" echo "Second Parameter : $2" echo "Quoted Values: $@" echo "Quoted Values: $*" echo "Total Number of Parameters : $#" Take a screenshot of the console output. Run your scripts after doing a chmod 777 on the script. Open a terminal window and run the following commands: which gcc man gcc#include <stdio.h> #include <stdlib.h> #include <unistd.h> #include <fcntl.h> int main(){ int stdout_bak = dup(STDOUT_FILENO); // make a backup of stdout system("rm -f mystery.txt"); // remove file using a shell command int out_fd = open("mystery.txt", // open file mystery.txt O_WRONLY|O_CREAT, // for writing, create if needed S_IRUSR|S_IWUSR); // give user read/write permission if(out_fd == -1){ // check for errors opening file perror("Couldn't open file 'mystery.txt'"); exit(1); // bail out if open fails } printf("1. Now you see me.\n"); // print to the screen dup2(out_fd, STDOUT_FILENO); // change stdout to go to mystery.txt printf("2. Now you don't!\n"); // print goes to mystery.txt close(out_fd); // close mystery.txt dup2(stdout_bak, STDOUT_FILENO); // restore stdout to screen…The provided Linux runtime memory image shows the address space for a program named exam that is running in memory. If the exam program calls the printf function that is defined in the libc library, then what type of linking was performed? 00400000-004b6000 x-xp 00000000 00:75 163237418 006b6000-006bc000 rw-p 000b6000 00:75 163237418 806bc000-006bd000 rw-p 00000000 08:00 0 820bc800-828df000 rw-p 00000000 08:00 0 7ffc02014000-7ffc02035000 rw-p eeeeeeee 00:00 0 A. Static OB. None are correct OC. Global OD. Dynamic Reset Selection /mnt/learncli/workdir/exam /mnt/learncli/workdir/exam [heap] [stack]