TABLE 5.2 Examples of Mammalian Genes That Are Imprinted* Allele Gene Expressed Function WT1 Maternal Wilms tumor-suppressor gene; suppresses cell growth Insulin; hormone involved in cell growth and metabolism INS Paternal Igf2 Paternal Insulin-like growth factor Il; similar to insulin Igf2R Maternal Receptor for insulin-like growth factor II UBЕЗА Maternal Regulates protein degradation; involved in Angelman syndrome Splicing factor; involved in Prader-Willi syndrome SNRPN Paternal Gabrb Maternal Neurotransmitter receptor "Researchers estimate that approximately 1-2% of human genes are subjected to genomic imprinting, but only about 100 have actually been demonstrated to be imprinted.

TABLE 5.2 Examples of Mammalian Genes That Are Imprinted* Allele Gene Expressed Function WT1 Maternal Wilms tumor-suppressor gene; suppresses cell growth Insulin; hormone involved in cell growth and metabolism INS Paternal Igf2 Paternal Insulin-like growth factor Il; similar to insulin Igf2R Maternal Receptor for insulin-like growth factor II UBЕЗА Maternal Regulates protein degradation; involved in Angelman syndrome Splicing factor; involved in Prader-Willi syndrome SNRPN Paternal Gabrb Maternal Neurotransmitter receptor "Researchers estimate that approximately 1-2% of human genes are subjected to genomic imprinting, but only about 100 have actually been demonstrated to be imprinted.

Name: On the left side of this figure, explain why the offspringdoes not hav
Uploaded: 2024-03-20T06:42:55.000Z
Channel: Bartleby
Description: On the left side of this figure, explain why the offspringdoes not have Prader-Willi syndrome but does have Angelman syndrome TABLE 5.2Examples of Mammalian Genes That Are Imprinted*AlleleGeneExpressedFunctionWT1MaternalWilms tumor-suppressor gene; s

Biochemistry

6th Edition

ISBN:9781305577206

Author:Reginald H. Garrett, Charles M. Grisham

Publisher:Reginald H. Garrett, Charles M. Grisham

Chapter32: The Reception And Transmission Of Extracellular Information

Section: Chapter Questions

Problem 21P

See similar textbooks

Similar questions

Cancer-promoting mutations are likely to have different effects on the activity of proteins encoded byproto-oncogenes than they do on proteins encodedby tumor-suppressor genes. Explain.
Design a pair of primers to amplify the human Insulin gene (only the blue region) Human Insulin CDNA (gene sequence, 5'-untranslated region, 3'-untranslated region) 5'agecete agccctccaggacaggctgcatcagaagaggccatcaagcagatcactgtccttctgccATGGCCCTGTGGA TGCGCCTCCTGCCCCTGCTGGCGCTGCTGGCCCTCTGGGGACCTGACCCAGCCGCAGCCTTTGTGAACCAAC АССТСTGCGGCTCАCАCСТGGTGGAAGCTCTCТАССТАGTGTGCGGGGAACGAGGCTTCTTCTACАCACСCА AGACCCGCCGGGAGGCAGAGGACCTGCAGGTGGGGCAGGTGGAGCTGGGCGGGGGCCCTGGTGCAGGCAGCC TGCAGCCCTTGGCCCTGGAGGGGTCCCTGCAGAAGCGTGGCATTGTGGAACAATGCTGTACCAGCATCTGCT CCCTCTACCAGCTGGAGAACTACTGCAACTAGacgcagcccgcaggcagccccccacccgccgcctcctgca ccgagagagatggaataaagcccttgaaccaacaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaŋ' Human insulin protein MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGG GPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN* 5'-C 5'-I ]-3' ]-3' Primer: I Primer: 2 I know the answers are 5'-ATGGCC-3' for primer 1 and 5'-CTAGTT-3' for primer 2 but I'm not sure why. Could some explain why?
Relative H3/H4 Acetylation Relative H4 Acetylation Relative НЗ Асetylation IION --- -4Kb -3Kb -2Kb -1Kb +1 Insulin You are studying histone modification at the insulin gene in cell types that express insulin (3 & A 4) compared to cell types that do not express insulin (1 & 2). eria Enhancer Promoter 20 15 10 5 Discuss with your pod: In which cell type(s) is H3 acetylation highest? 2. In which cell type(s) is H4 acetylation highest? 3. Is histone acetylation the same at the enhancer and promoter? 4. Based on the data, which histone modification is most important for activating insulin gene expression? 0- 1. 20 De 15 10 C
Describe the effects of the over-expression of mdm2 on cell proliferation and apoptosis on cell signaling pathways and metabolism or cell cycle control. Briefly explain the normal role of each component in the context of the pathway and why its loss or modification would have the expected effect.
Although numerous treatments are available for advanced hormone receptor- positive (HR+) and human epidermal growth factor receptor 2 negative (HER2-) breast cancers, they are rarely curable. Drugs such as palbociclib that inhibit cyclin-dependent kinase 4 and 6 (CDK4/6) are rapidly altering this therapeutic environment. Discuss the function of CDK4 and CDK6 in promoting cell growth as well as the overall effects of their inhibition by palbociclib on the progression of the cell cycle.
The oscillatory clock that drives somite forma-tion in vertebrates involves three essential componentsHer7 (an unstable repressor of its own synthesis), Delta (atransmembrane signaling molecule), and Notch (a trans-membrane receptor for Delta). Notch is bound by Delta onneighboring cells, activating the Notch signaling pathway,which then activates Her7 transcription. Normally, thissystem works flawlessly to create sharply defined somites(Figure Q21–2A). In the absence of Delta, however, onlythe first five somites form normally, and the rest are poorlydefined (Figure Q21–2B). If a pulse of Delta is suppliedlater, somite formation returns to normal in the regionswhere Delta was present (Figure Q21–2C). A diagram ofthe connections between the components of the clockand how they interact in adjacent cells is shown in FigureQ21–2D. In the absence of Delta, why do the cells becomeunsynchronized? What is it about the presence of Deltathat keeps adjacent cells oscillating in synchrony?
"Schematic outline of melanogenesis. UVR stimulates the expression of POMC by keratinocytes. The peptide produced is the precursor of the hormone a-MSH, that binds to MC1R in melanocytes. This union leads to an increase in cellular cyclic adenosine monophosphate (cAMP) that in turn leads to increased levels of MITF expression, which upregulates the transcription of TYR, TYRP1 and TYRP2, producing brown-black eumelanin. In the absence of a-MSH, the antagonist ASIP binds to MC1R, and phaeomelanin is synthetized instead. Melanosomes are then transferred to keratinocytes through the dendrites via a shedding vesicle system." Briefly discuss how these several aspects of the molecular and cellular biology of melanin production and melanosome transfer contribute to determine skin color. How would different mutations in the hormonal response to ultraviolet light, the melanin production signal transduction pathways, and melanosome transfer influence skin color, hair color, and eye color? Did…
Erythritol is a natural sugar abundant in fruits and fermentingfoods. Pathogenic bacterial strains that catabolize erythritolcontain four closely spaced genes, all involved in erythritolmetabolism. One of the four genes (eryD) encodes a productthat represses the expression of the other three genes. Erythritolcatabolism is stimulated by erythritol. Present a regulatorymodel to account for the regulation of erythritol catabolism insuch bacterial strains. Does this system appear to be underinducibleor repressible control?
Vitamin A, retinoids, plays critical roles in development. Explain the molecular mechanism through which retinoids regulate epithelial cell proliferation and differentiation. Please include vitamin A metabolites and their nuclear receptor.
Discuss the family of nuclear hormone receptors and explain how ligand binding to such a receptor can result in changes in gene expression
1. Which G protein activates Phospholipase C (PLC)? 2. What phospholipid does PLC cleave to produce second messengers? 3. What are the properties of these 2 second messengers? 4. Which second messenger opens a ligand gated ion channel in the ER? 5. Which hydrophobic second messenger activates protein kinase C? 6. Which hydrophilic second messenger activates protein kinase C by increasing cytosolic Ca2+ levels which allows Ca2+ to bind to PKC? Kinases 2 Phosphatidylinositol (PI) PI 3-kinase PLC PI 4,5-bis-phosphate (PI-4,5-bisP) Plasma membrane cog Diacylglycerol (DAG) Inositol 1,4,5-tris-phosphate (IP3) Second messengers PI 3,4,5-tris-phosphate (PI-3,4,5-trisP) domains 000 Docking site for pleckstrin homology Cell membrane PIP 20 Phospholipase C cleavage IP 3 VIVAL ER membrane 00 Calcium ion iii DAG Calcium ion Figure 13.12 Biochemistry, Third Edition 2015 W.H. Freeman and Company Diacylglycerol (DAG) Protein kinase C IP 3 receptor MY 99 Cytoplasm
How would a mutation in ras that leads to formation of a Ras proteinwith no GTPase activity affect a cell’s response to insulin?