How does the predicted molecular weight of AlaE (16949.07) compare with the molecular weight of the unmodified protein in the Western Blot attached? Are they consistent?
Q: Many pharmaceuticals exert their action by inhibiting the activity of enzymes. Choose the false…
A: Enzyme inhibition occurs when certain substances, called inhibitors bind to and inactivate enzymes.…
Q: 54 In the alpha helix shown below, all carbonyl groups are pointing_ amino groups are pointing_…
A: Proteins show four levels of structural organisation. Primary level of organisation involves the…
Q: What is the relationship between the following monosaccharides (enantiomers, diastereomers, or…
A: Enantiomers are stereoisomers that are mirror images of each other. The D and L forms of a sugar are…
Q: What is the amino acid most similar to the structure below? Just type the name (one word). H3C Se…
A:
Q: What part of the cell is the molecule depicted below most likely to be located? cytoskeleton nuclear…
A: Lipids are a chemically diverse group of biomolecules that have two things in common:low solubility…
Q: Draw the following amino acids linked by peptide bonds: a. aspartate b. lysine c. cysteine d.…
A: Amino acids are compounds containing carbon, hydrogen, oxygen and nitrogen. They are monomers or…
Q: Was it appropriate to use human serum protein as the standard when you were analyzing egg proteins…
A: When analyzing egg proteins in unknown samples, using human serum protein as a standard may not be…
Q: 6. Consider the heptapeptide DERHHKY. What is the overall charge of this peptide at pH 5 and pH 7.4?…
A: Amino acids are organic molecules that form the building blocks of proteins. They contain an amino…
Q: Which Ami no acids can be found in the following peptide?
A: Amino acids are biomolecules that have a hydrogen atom, an amino group, a carboxyl group and a side…
Q: Genetics 8 Q6
A: The objective of the question is to understand the possible outcomes of non-disjunction during the…
Q: Q5. A sh mutant called shXS is isolated that produces a truncated polypeptide of only 6 AAs in…
A: The objective of the first question is to identify a single basepair DNA change that would lead to a…
Q: Blood plasma contains a total carbonate pool (essentially HCO3 and CO₂(d)) of 2.5 x 10-2 M. What…
A: In order to solve this problem, first we need to calculate the initial concentrations of bicarbonate…
Q: what metabolic pathways are more likely to be active during: a) fasting, b) overnight fast) and c)…
A: Intermediary metabolism, also known as metabolic pathways, is the intricate network of chemical…
Q: Not all the bases of an mRNA message are used for coding. Which of the following is a possible…
A: mRNA is messenger RNA that is translated by the ribosomes and generate a protein product. It has…
Q: Sketch the pH speciation diagram for asparagine for the range of 1 < pH < 12, annotate with the…
A: Asparagine is aliphatic, polar uncharged amino acid with carboxamide in its side chain. It is…
Q: How many dissociable protons are present in Tris buffer? How did you come to this conclusion?…
A: Tris buffer is also known as tris(hydroxymethyl)aminomethane. It is an organic compound with the…
Q: To track cell growth and utilization of the limiting substrate in a bioreactor, the yield is…
A: S=Y(X0−S0)X−X0+S0Explanation:Lag Phase: The growth rate is zero (μ = 0) since there is no…
Q: GQ 4
A: The objective of the question is to determine the probability of Diane's next son being colorblind,…
Q: Question 6
A: The question is asking us to identify a characteristic that is unique to sister chromatids during…
Q: The two pKas of a simple amino acid (i.e., side chain does not ionize) are 1.99 and 9.48 for the…
A: An amino acid is simply an alpha-carbon bonded to 4 groups. The 4 groups are;an alpha-carboxyl…
Q: (b) The actual resting membrane potential of the cell is not only dependent on the individual…
A: Nernst equation gives us the resting membrane potential contributed by a single ion. The Nernst…
Q: (2) If C-1 of glucose is radioactively labeled and then enters glycolysis, whic carbon of…
A: Carbon tracking (or tracing) is a technique used to track carbons in a biomolecule as it undergoes a…
Q: Rate in U [S] in mM No Inhibitor 0.5 1.0 2.0 4.0 8.0 16.0 32.0 64.0 0.22 0.41 0.73 1.12 1.57 2.01…
A: The Michaelis-Menten kinetics is the simplest and best model to understand enzyme kinetics, and it…
Q: Sickling occurs in deoxyhemoglobin S but not in oxyhemoglobin S. Oxyhemoglobin has a small,…
A: Sickling is the process where the haemoglobin protein inside the RBC cell clumps together this…
Q: Genetics Question 4 How would I do this with multiple punnet squares?
A: The objective of the question is to understand how to use multiple Punnett squares to solve…
Q: Please fill in the four boxes bolded below you KM (MM) Vmax (nM/s) Type of inhibition…
A: Competitive inhibitors are the substances which are similar to substrate molecules in their…
Q: Luther found a vial containing an unknown lipid sample. He separated the different lipids using gel…
A: The dimensionless number is used in TLC to measure a substance's relative movement concerning the…
Q: Given, isas ri Glucose + Pi→ Glucose-6-P ATP + H₂O → ADP + Pi Determine K 'eq for a coupled reaction…
A: Consider a reaction ; A B. Its biochemical equilibrium constant (K'eq 1) will be;Now consider a…
Q: 2) You are studying the tripeptide Lys-Val-Thr. a) Draw the full structure of the tripeptide…
A: Pepetides are composed of amino acids. Amino acids are biomolecules where a carbon atom (called…
Q: Which of the following is the basic difference between serological (blow-out) and measuring…
A: A pipette is a sort of laboratory instrument that is frequently used in biology and chemistry to…
Q: A peptide has the sequence Glu-His-Trp-Ser-Gly-Leu-Arg-Pro-Gly The pK₂ values for the peptide's side…
A: Recall that:Amino acid sequences are written with N-terminal amino acid on the left and C-terminal…
Q: Assuming I got 1, 2, and 3 right can you please help with 4?
A: The objective of this question is to determine which generation the phenotype of the F2…
Q: What value of [S], as a fraction of KM, is required to obtain 80% of Vmax? (Hint: use the MM…
A: We need to use the Michaelis-Menten (MM) equation shown below to solve this question.
Q: Alpha helices are a type of secondary structure in proteins. What is the length of a 23.0 kDa…
A: The alpha helix is a relatively common motif among the secondary structure of proteins - a secondary…
Q: Amino acids- Draw out the amino acid structure for one amino acid from the list of 20. Label all…
A: Amino acids are the building blocks of proteins that are made up of an amino group and a carboxylic…
Q: 22. For the process, A B, Keq is 0.02 at 37°C. For the process, BC, Keq 1000 at 37°C. A. Determine…
A: The objective of the question is to determine the equilibrium constant for the overall process A…
Q: You have a peptide that has the following amino acid sequence: GPMG Draw the structure of the…
A: Peptides are short chains of amino acid residues that are linked together via a peptide bond. The…
Q: Choose the correct structure for thiamine hydrochloride at pH 10. H3C H3C N NH₂ NH₂ CI- `N A CI- с…
A: The relationship between pH and pKa is described by the Henderson-Hasselbalch equation:pH = pKa +…
Q: Consider a gene being transcribed at a constant rate k1 and being degraded with first order…
A: The genetic information from protein synthesis is stored in DNA. This information is copied onto an…
Q: G Which of the following amino acids is most unlikely to be present in a beta sheet? Lysine Valine…
A: Proteins show two types of secondary structural elements. They are1) Alpha helix and2) Beta sheets .…
Q: If non-disjunction occurs at meiosis 2 in a male, 2 of the 4 sperm formed in that meiosis will have…
A: Non-disjunction can happen in meiosis 1 or meiosis 2.Non-disjunction is said to have taken place in…
Q: 4. In the reaction in which glyceraldehyde 3-phosphate is oxidized to 3-phosphoglycerate, which…
A: The process of oxidation and reduction in a reaction is collectively called Redox reaction. During a…
Q: You are working on a protein with the following sequence in an area of interest.…
A: Proteins are made up of different amino acids. Some amino acids have ionizable side chains. All…
Q: the overall, net ionic charge on this peptide at pH = 7 would be: Cys - Ala - Glu - Arg - Met - Ser
A: The charge of the peptide is due to the ionizable groups present in the amino acids.The charge on…
Q: Solution is incorrect, please help
A: Amino acids are building blocks of proteins which contains both an amine group (-NH2) and a carboxyl…
Q: Which property increases in magnitude during the steps of sequential purification of an enzyme?…
A: Enzyme purification is defined as a process by which enzymes are separated and isolated from other…
Q: Use the scoring system described to calculate the alignment score for IPNIA A IG D V VAG P VKGIYA V…
A: The alignment score is the sum of individual matches when two or more DNA or protein sequences are…
Q: -OH + HO + H2O + CO2
A:
Q: Identify the true statements regarding disulfide bridges (disulfide bonds). Disulfide bridges are…
A: Disulphide bonds or disulphide bridges are the covalent bonds formed between the thiol groups of two…
Q: Identify 2 independent helices domains Identify a disordered region In the structure, box the…
A: Proteins are essential molecules that perform many important functions in cells. They are made up of…
How does the predicted molecular weight of AlaE (16949.07) compare with the molecular weight of the unmodified protein in the Western Blot attached? Are they consistent?
Step by step
Solved in 3 steps with 2 images
- 10- 00 O SCNSA-SCN10A CDKN1A HANDI VTI1A SYTI • MYOCD 9 10 11 12 13 14 15 16 17 18 19 20 2122 X Y11 111 FLATRON WIS songs to listen to on a late n (1) Messenger f 253282375 390061782796379 8 x ++ Scontent.fmnl17-4.fna.fbcdn.net/v/t1.15752-9/253282375 390061782796379 8678836692018933574_n.jpg?_nc_cat3D105&ccb%3D1-5&_nc_sid=Dae9488&_nc_eui2=DAeERUdQ E Apps Discussion Questions (answer these questions on a separate sheet of paper) 1. Explain how hCG secretion is regulated. Is it secreted by a pregnant woman or her offspring? 2. hCG depresses some reactions of the immune system. What adaptive advantage do you think this has? Ac P Type here to search LGBM4_DNA AND PROTEIN S X /1FAIPQLSDP_g5B-629FSHNpGnTMIEppLS4A71zBd4vcUBqNUILubXONw/formResponse 4. What is the nitrogen base pair of Adenine in transcription? O Cytosine O Uracil O guanine O thymine 5. The central dogma of Molecular Biology states that There are four nitrogen bases in DNA, two purines (adenine and guanine) and two pyrimidines (cytosine and thymine). Which process is not included in the central dogma? duplication transcription translation O translocation Leadple
- Design 6 bp primers to amplify the region of this sequence that is highlighted in yellow. attatatttt atattatata ctctgggctc agagcagccc 40 41 atattatata tatatatttt aaaatattat aaatttattt 80 81 cagtcacgcg tcctgatgac attatatttt ataatttttt 120 121 ttttattttt attatatttt aaaatattat aaatttattt 160 161 aaaatattat tatatattta aaatttattt attataaaat 200 201 aaaatattat ttttattttt gagatcagga cggctgcatg 240 Forward primer Reverse primerIn sequencing, dideoxyribonucleotides (ddNTP) are used that terminate the amplification. Why do they terminate the amplification?GTTTTCACTGGCGAGCGTCATCTTCCTACT 8. What is the function (e.g. transcriptional regulation, transmembrane signaling, kinase, protease, etc.) of the protein(s) encoded by the gene.
- 15.3 Explain the fellovine diaeram: prospective nuclear protein nuclear Ran HYDROLYZES ITS BOUND GTP, localization Ran-GDP ignal Ran-GDP DISSOCIATES PROTEIN BINDS FROM RECEPTOR TO RECEPTOR nuclear pore CYTOSOL NUCLEUS Ran-GTP BINDS PROTEIN DELIVERED TO NUCLEUS TO RECEPTOR Ran-GTP 15.4 EXplain the followine.diBEram: SRP displaced and released for reuse MRNA ribosome signal- recognition particle (SRP) CYTOSOL growing- polypeptide chain ER signal sequence ER LUMEN SRP receptor protein translocator Ngam 1514 Iereoog ed.arinde 15.5 Explain the following.diaeram: newly synthesized soluble proteins for constitutive newly synthesized plasma membrane lipids transport vesicde secretion CONSTITUTIVE SECRETION unregulated exocytosis plasma membrane newly synthesized plasma membrane protein extracellular signal such as trans Golgi network homone or neurotransmitter signal transduction REGULATED SECRETION regulated екосуtosis secretory vesicle storing secretory proteins Golgi apparatus CYTOSOL…In Figure 9-12(b), what do you think happens to thetRNA that is released from the E site?Q3. Cystic fibrosis is an autosomal recessive inherited disorder that causes severe damage to the lungs, digestive system and other organs in the body. Cystic fibrosis affects the cells that produce mucus, sweat and digestive juices. The disease occurs when there is a mutation in the cystic fibrosis transmembrane conductance regulator (CFTR) gene, which is the gene responsible for the movements of negatively charged particles known as chloride ions into and out of cells. Using the base pairing rules and the codon table, determine the mRNA and protein sequences produced by the CFTR gene's segment (below). Transeription begins at and includes the bold and underlined G nucleotide. CFTR gene's segment. - GCGATGTACAACCGAGGGTAAAAAA - 3' coding sequence a) The DNA template sequence 3'.. ...5' b) Fill in the first 9 nucleotides of the primary/ nascent mRNA transcribed from Gene A. 5'-.... -3' c) Protein N-term... . . C- terminus d) Exposure to cigarette smoke (a known mutagen) deletes base #9…
- would the J3480 Code and 59 Modifer Code go on seperate lines under the HCPCS Level II codes column?These sequences are derived from the middle region of the covid-19 spike protein. Which choice or choices would not have m/z signature(s) that would allow them to be identified as tryptic peptide(s)? YNENGTITDAVDCALDPLSETK VDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEK RVQPTESIVfunction of a Src homology-3 (SH3) domain?