the context of this image is that it is from the GEO website and what to do is to write 500 words for the results section of a report using the image. the title is Identification of Differentially Expressed Genes in Breast Cancer Using RNA-Seq
Q: 9. The Pitx1 protein has important functions in various tissues during stickleback development. The…
A: Pitx1 may be a gene that encodes a protein involved in the development of different tissues in the…
Q: Which type of cytoskeletal element is characterized as a hollow, rigid cylindrical tube with walls…
A: The question is asking to identify the type of cytoskeletal element that is described as a hollow,…
Q: mulation Activity ctivity, you will be provided with the DNA nucleotide ce that codes for a…
A: DNA is a double helical molecule that helps in the transcription of mRNA which is eventually…
Q: Subject: Environmental Physiology Explain how the differences in the thermal characteristics of…
A: The objective of this question is to understand the impact of thermal characteristics of terrestrial…
Q: Microbial communities and Coral Reef restoration .Indicate the type of research you will be…
A: The objective of this question is to design a research plan for studying the relationship between…
Q: Describe three notable characteristics common to most reptiles. Think about diet, dentition, limbs,…
A: The first characteristic to consider is the diet and dentition of reptiles. Most reptiles are…
Q: List one other cancer, human or animal in which a mitotic index may be used in diagnostics or tumor…
A: The objective of the question is to identify a type of cancer where the mitotic index is used in…
Q: Examine the trait distribution of Specific Leaf Area (The ratio of leaf area to dry mass, SLA),…
A: Polygenes are members of a group of non epistatic genes that mainly interact additively to…
Q: Part 2 Bio Question 8
A: The objective of the question is to determine where the Pitx1 gene would be expressed given a…
Q: what provides an image that is three-dimentional representation with little magnification (two…
A: The question is asking for a tool or device that can provide a three-dimensional image with little…
Q: Yeast + hydrogen peroxide observation a. feels warm to the touch b. feels cold to the touch c.…
A: The question is asking about the type of reaction that occurs when yeast is mixed with hydrogen…
Q: Question 4
A: The question is asking about the famous experiment conducted by Oswald Avery and his colleagues in…
Q: Part 1 Bio Question 2
A: The objective of this question is to understand the function of regulatory switches, also known as…
Q: Disruptive selection is the promotion of _____. the standard form of a trait…
A: Disruptive selection, also known as diversifying selection, is a type of natural selection that…
Q: Which answer is the best choice to complete this model of a freshwater fish? Loses ions Gains Pumps…
A: Homeostasis refers to any process that helps organisms maintain fairly stable conditions that are…
Q: For each statement below, state whether it is true of DNA, RNA, Both DNA and RNA, or Neither DNA nor…
A: The statement is "Can contain the nucleotide Uracil." Uracil is a nitrogenous base that is only…
Q: Subject: Environmental Physiology True or false: Urine dilution by the loop of Henle is dependent on…
A: FalseExplanation:The loop of Henle plays a crucial role in urine concentration and dilution in the…
Q: What is Human Genome Project? What are its goals and benefits? What are the ethical, legal, and…
A: The genome is made up of genes and genes are made up of DNA. DNA is present inside the chromosomes…
Q: You are running your first ELISA and make some mistakes. What would happen if each of the following…
A: The objective of the question is to understand the impact of various mistakes that can occur during…
Q: Genetics Question 4
A: The objective of the question is to identify the differences between RNA and DNA. This involves…
Q: Herophilus from Chalcedon identified how many chambers in the human heart? 6 chambers: the right…
A: The question is asking about the number of chambers in the human heart that were identified by…
Q: Unhealthy saturated fats are often animal-based, while the more healthy unsaturatedfats are often…
A: The comparison between saturated fats in cow's milk and unsaturated fats in soy milk highlights the…
Q: Norepinephrine acts on heart muscle cells by: Group of answer choices blocking the action of…
A: Norepinephrine is a neurotransmitter and hormone that plays a key part within the body's…
Q: Which of the following statements is most accurate ? All statements are accurate All prescribed…
A: The objective of the question is to identify the most accurate statement among the given options.
Q: Two nonhomologous chromosomes have the following segments, where * represents the centromere:…
A: Two nonhomologous chromosomes have the following segments, where * represents the…
Q: Please answer both questions. Question 1 A mutation occurs in a population of rabbits affecting ear…
A: Population : A population is a group of individuals of same species .Population genetics : It is the…
Q: Genetics Question 1
A: The objective of the question is to understand the correct order of the processes in gene…
Q: Q6.10. Which of the following is the best explanation for why extinctions are more likely with…
A: Isle Royale Simulation: Why Longer Growing Seasons Increase Extinction RiskThe most likely…
Q: Allowing all drunk-driving suspects (driving erratically) to complete the above sobriety test in 60…
A: The objective of the question is to understand the impact of increasing the time allowed for a…
Q: Why does the right ventricle have a bicuspid valve? a. The low pressure generated by the right…
A: The question is asking why the right ventricle of the heart would have a bicuspid valve. The…
Q: The chemical structure of food coloring and oil are not provided on their packaging, but based on…
A: The objective of the question is to predict the chemical structure of food coloring and oil based on…
Q: Which process is responsible for creating unique recombinant chromosomes during meiosis?
A: The objective of the question is to identify the process that leads to the creation of unique…
Q: Caffeine inhibits feeding activity in tobacco hornworm larvae by inhibiting phosphodiesterase (PDE)…
A: The objective of the question is to understand how caffeine affects the feeding activity of tobacco…
Q: FUNGI LIFESTYLE REPRODUCTION LIFE CYCLE RELEVANCE Microsporidia (outgroup) Chytrids Zygomycetes…
A: Microsporidia:Lifestyle: Obligate intracellular organism that lives in the body of another organism…
Q: Subject: Environmental Physiology True or false: The process of an organism losing heat to the…
A: True. The process of an organism losing heat to the boundary layer decreases with wind speed. This…
Q: 1. Figure 1 is a diagram, similar to the one shown in the film (8:00-8:24), showing key components…
A: Gene transcription is the fundamental process by which the genetic information encoded in DNA is…
Q: What is the pH of a buffer solution that is 0.20 M proprionic acid (HC3H4O2) and 0.1 M sodium…
A: pH = 4.59Explanation:
Q: Experiment Mouse injected with type S Mouse injected with type R Lived or Died Mouse injected with…
A: According to our guideline we can answer only the first question (up to there subparts). All the…
Q: what is the main cause of a different number of chromosomes in some p
A: The objective of the question is to understand the main cause of variation in the number of…
Q: What could the lengths of the branches on the x-axis represent? (choose all that apply, no partial…
A: The theory behind phylogenetic trees, also known as evolutionary trees, revolves around the concept…
Q: tudent forgot to add GelRed in to the gel mixture when he prepared the Agarose Gel. What will be the…
A: GelRed is a fluorescent nucleic acid stain commonly used in molecular biology laboratories for…
Q: One hand was in ice water for one minute, and the other in hot water for one minute. After placing…
A: The answer is given below. If you have any further queries or needed extra information in the…
Q: Which of the below would best be described as a metapopulation? Killer whales are predicted to…
A: Populations of a species that are geographically distinct yet linked by sporadic migration or…
Q: 3. In 1940 there were 12 whooping cranes in the population. In 1945, five years after hunting…
A: Question 3: To estimate the population size for whooping cranes in 1965 using the given growth rate,…
Q: QUESTION 3 Linkage disequilibrium is defined by which of the following? O Positions in the genome…
A: For QUESTION 3:The correct answer is: The nonrandom association between alleles in a…
Q: What is a second messenger? What are two second messengers that are involved in signaling pathways…
A: Second Messenger:A second messenger is a signaling molecule that is produced inside a cell in…
Q: how do i expand this into 1000 words The objective is to interpret the results of an RNA-Seq…
A: Interpreting the results of an RNA-Seq analysis is pivotal in understanding the underlying genetic…
Q: Calculate the two possible values of x in this equation: x2 – 11x + 24 = 0, either by using the…
A: The objective of this question is to find the roots of the quadratic equation x^2 - 11x + 24 = 0.…
Q: A Lab Data Environment: Clean Forest Moths Released G1 G2 G3 G4 G5 Typica 250 166 259 372 521 851…
A: Phenotypic frequency corresponds to how many times a particular phenotype is observable in a given…
Q: The only living group of mammals that lay eggs rather than give birth to live young are called: A)…
A: The question is asking for the name of the group of mammals that lay eggs instead of giving birth to…
the context of this image is that it is from the GEO website and what to do is to write 500 words for the results section of a report using the image. the title is Identification of Differentially Expressed Genes in Breast Cancer Using RNA-Seq
Step by step
Solved in 3 steps
- PLEASE MAKE THE DR BRUJIN GRAPH From these k-mers construct a de Bruijn graph and determine the sequence of the contig. AGCG ATCT ATGA ATGG ATTC CCCT CCTG CTCT CTGA CTGC CTTT GAAG GATT GCGT GCTC GTTC TATG TCAT TCTA TCTT TGAA TGAT TGGA TGTT TTCA TTCC TTTCPathogenic E. coil have recently been shown to degrade tight junction proteins during infection. How would this provide an advantage to the bacteria?GTTTTCACTGGCGAGCGTCATCTTCCTACT 8. What is the function (e.g. transcriptional regulation, transmembrane signaling, kinase, protease, etc.) of the protein(s) encoded by the gene.
- SspI --- 5' AAT - ATT 3'5' GGATAATATT GTTAACAATCTCTACGGGTTAACACCCTTGGAATATTTTAA 3' 3' CCTATTATAACAATTGTTAGAGATGCCCAATTGTGGGAACCTTATAAAATT 5' Number of pieces of DNA _______Multisubunit proteins in which some or all of the subunitsare identical are referred to as _______________________.3’-TCTTCGTGAGATGATATAAGAGTTATCCAGGTACCGGTAAACTGG-5’ 5’-AGAAGCACTCTACTATATTCTCAATAGGTCCATGGCCATTTGACC-3’ Write down the mRNA transcript from DNA above.
- If the following nucleotide sequence represents the active domain of the COVID19’s M-protein 5’ ---- 5’ GGGUACAUGGUAGCCCCCGUCGAGAAAACACCC …. 3’ a) describe a potential mutation that may occur and the mechanism that could fix it b) if the repair mechanism is faulty, explain the consequences for COVID19 & that of the infected individualThree polypeptides, the sequences of which are represented below using the one-letter code for their amino acids, are present in a mixture:1. ATKNRASCLVPKHGALMFWRHKQLVSDPILQKRQHILVCRNAAG2. GPYFGDEPLDVHDEPEEG3. PHLLSAWKGMEGVGKSQSFAALIVILAOf the three, which one would migrate most slowly during chromatography through:(a) an ion-exchange resin, beads coated with positively charged groups?(b) an ion-exchange resin, beads coated with negatively charged groups?(c) a size-exclusion (gel-filtration) column designed to separate small peptides such as these?(d) Which peptide contains the ATP-binding motif shown in the following sequence logo?Which of the following set(s) of primers a–d couldyou use to amplify the following target DNA sequence, which is part of the last protein-coding exonof the CFTR gene?5′ GGCTAAGATCTGAATTTTCCGAG ... TTGGGCAATAATGTAGCGCCTT 3′3′ CCGATTCTAGACTTAAAAGGCTC ... AACCCGTTATTACATCGCGGAA 5′a. 5′ GGAAAATTCAGATCTTAG 3′;5′ TGGGCAATAATGTAGCGC 3′b. 5′ GCTAAGATCTGAATTTTC 3′;3′ ACCCGTTATTACATCGCG 5′c. 3′ GATTCTAGACTTAAAGGC 5′;3′ ACCCGTTATTACATCGCG 5′d. 5′ GCTAAGATCTGAATTTTC 3′;5′ TGGGCAATAATGTAGCGC 3′
- In a mixed copolymer experiment, messages were created witheither 4/5C : 1/5A or 4/5A : 1/5C. These messages yielded proteinswith the following amino acid compositions.4/5C : 1/5A (% yield) 4/5A : 1/5C (% yield)Proline 63.0 3.5Histidine 13.0 3.0Threonine 16.0 16.6Glutamine 3.0 13.0Asparagine 3.0 13.0Lysine 0.5 50.098.5 99.1Using these data, predict the most specific coding composition foreach amino acid.62) If you want to inhibit protein synthesis on the transcriptional level you would use: a) Tetracyclin b) Vancomycin c) Macrolides d) Fluroquinolones e) a & c 63) The protein that prevents the formation of off-centered septation in bacteria is: a) FtsZ b) MreB c) MinCD d) Tubulin e) Septin 64) The autoclave pressure must reach at least ________ in order to effectively kill the bacterial spores: a)15 psi b) 15 Joules c) 15 Kilograms d) 15 Lbs e) 15 Kilocalories 65) Incineration is a type of ______ method in controlling bacterial growth: a) moist heat b) dry heat c) chemical d) chemotherapeutic e) genetic.6_c. In cancerous cells, CpG islands are: where intercalating agents are found demethylated methylated.